PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.015G034100.1
Common NamePOPTR_0015s05050g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family HD-ZIP
Protein Properties Length: 726aa    MW: 79739.5 Da    PI: 6.7794
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.015G034100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.91.9e-192782156
                        TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                        +++ +++t+ q++ Le++F+++++p++++r +L+++lgL  rq+k+WFqNrR+++k
  Potri.015G034100.1 27 KKRYHRHTALQIQKLESMFKECPHPDEKQRLQLSRELGLAPRQIKFWFQNRRTQMK 82
                        678899***********************************************998 PP

2START193.21.3e-602214422206
                         HHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS.......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....E CS
               START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetla....k 78 
                         +a  a++el+++ + +ep+W+kss    + +n d + ++f+++ +       ++ea+r+sgvv+m+ + lv  ++d++ +W e ++     
  Potri.015G034100.1 221 VAANAMEELLRLLQTNEPLWMKSSadgrDVLNLDSYQRIFPRAMShlknpnVRIEASRDSGVVIMNGVALVDMFMDSN-KWVESFPtmvsV 310
                         67899**********************9999999999999998779999999**************************.99999999999* PP

                         EEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEE CS
               START  79 aetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghs 162
                         a+t+evissg      g lqlm+ elq+lsplvp R+f ++Ry++q ++g w+iv+vS d +q+ ++     R+++lpSg+li++++ng+s
  Potri.015G034100.1 311 AKTIEVISSGmlgshsGSLQLMYEELQVLSPLVPtREFCILRYCQQIEQGLWAIVSVSYDIPQFASQ----FRCHRLPSGCLIQDMPNGYS 397
                         ****************************************************************987....******************** PP

                         EEEEEE-EE--SSXX.HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
               START 163 kvtwvehvdlkgrlp.hwllrslvksglaegaktwvatlqrqcek 206
                         kvtwvehv+ ++++  h+l+r l++sg+a+ga +w+atlqr ce+
  Potri.015G034100.1 398 KVTWVEHVEIEDKTTtHQLYRDLIHSGMAFGAERWLATLQRMCER 442
                         *************999***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.92E-20984IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-221178IPR009057Homeodomain-like
PROSITE profilePS5007117.8152484IPR001356Homeobox domain
SMARTSM003891.8E-182588IPR001356Homeobox domain
CDDcd000862.04E-182685No hitNo description
PfamPF000465.2E-172782IPR001356Homeobox domain
PROSITE patternPS0002705982IPR017970Homeobox, conserved site
PROSITE profilePS5084851.974211445IPR002913START domain
SuperFamilySSF559617.69E-39212443No hitNo description
CDDcd088752.52E-120215441No hitNo description
SMARTSM002342.0E-54220442IPR002913START domain
PfamPF018524.3E-53221442IPR002913START domain
Gene3DG3DSA:3.30.530.208.7E-9288427IPR023393START-like domain
SuperFamilySSF559612.11E-20463717No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009828Biological Processplant-type cell wall loosening
GO:0010091Biological Processtrichome branching
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 726 aa     Download sequence    Send to blast
MEYGSVGGGT SGGGGGDHDS SDPQRRKKRY HRHTALQIQK LESMFKECPH PDEKQRLQLS  60
RELGLAPRQI KFWFQNRRTQ MKAQHERADN SSLRAENDKI RCENIAIREA LKNVICPSCG  120
GPPVTEDSYF DEHKLRMENV QLKEELDRVS SIAAKYIGRP ISQLPPVQPF HISSLDLSMG  180
NFGAQGIGGP SLDLDLIPTS SNLAFQPPVI SDMDKSLMTD VAANAMEELL RLLQTNEPLW  240
MKSSADGRDV LNLDSYQRIF PRAMSHLKNP NVRIEASRDS GVVIMNGVAL VDMFMDSNKW  300
VESFPTMVSV AKTIEVISSG MLGSHSGSLQ LMYEELQVLS PLVPTREFCI LRYCQQIEQG  360
LWAIVSVSYD IPQFASQFRC HRLPSGCLIQ DMPNGYSKVT WVEHVEIEDK TTTHQLYRDL  420
IHSGMAFGAE RWLATLQRMC ERVACQMVSG NSTRDLGGVI PSPEGKRSMM KLAQRMVSSF  480
CSSISTSNSH RWSTLSGLHD VGVRVTLHKS TDPGQPNGVV LSAATTFSLP VSPQNVFSFF  540
KDERTRPQWD VLSSGNAVQE VAHITNGSHP GNCISVLRVR LSLFGSFSTF YSDCFTAYNT  600
SQNNMLILQE SCVDSSGSLV VYCPVDLPAI NIAMSGEDPS YIPLLPSGFA ISPDGRPDQG  660
DGASTSSNTQ GSTARLSGSL ITVAFQILVS SLPSAKLNLE SVNTVNNLIG TTVQQIKAAM  720
NCPSS*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.129930.0bud
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00232DAPTransfer from AT1G73360Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006374213.10.0homeobox-leucine zipper family protein
SwissprotQ9FX310.0HDG11_ARATH; Homeobox-leucine zipper protein HDG11
TrEMBLB9N3B20.0B9N3B2_POPTR; Homeobox-leucine zipper family protein
STRINGPOPTR_0015s05050.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF10263398
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73360.10.0homeodomain GLABROUS 11